Rabbit Anti-TRIP6 Polyclonal Antibody – Cat# MBS6397305

Western Blot analysis of TRIP6 expression in transfected 293T cell line by TRIP6 polyclonal antibody. Lane 1: TRIP6 transfected lysate (50.3kD). Lane 2: Non-transfected lysate.

TRIP6 Antibody – Rabbit Polyclonal

Name: TRIP6 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6397305
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6397305

This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic… More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

TRIP6, Polyclonal Antibody

Full Product Name

TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-relate

Product Gene Name

anti-TRIP6 antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human TRIP6.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

602933

3D Structure

ModBase 3D Structure for Q15654

Immunogen

Full length human TRIP6, aa1-476 (NP_003293.2).

Immunogen Sequence

MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC

Conjugate

Biotin

Note

Preservative Free

Product Categories/Family for anti-TRIP6 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

Applications Tested/Suitable for anti-TRIP6 antibody

Western Blot (WB)

Application Notes for anti-TRIP6 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-TRIP6 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for TRIP6 purchase

MBS6397305 is an antibody targeting TRIP6. Also known as TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-relate. Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for TRIP6. It may not necessarily be applicable to this product.

NCBI GI #

91208422

NCBI GeneID

7205

NCBI Accession #

NM_003302.2

UniProt Primary Accession #

Q15654

UniProt Related Accession #

Q15654

GenBank Nucleotide #

NM_003302.2

NCBI Official Full Name

Homo sapiens thyroid hormone receptor interactor 6 (TRIP6), mRNA

NCBI Official Synonym Full Names

thyroid hormone receptor interactor 6

NCBI Official Symbol

TRIP6

NCBI Official Synonym Symbols

OIP1; OIP-1; ZRP-1; TRIP-6; TRIP6i2

UniProt Protein Name

Thyroid receptor-interacting protein 6

UniProt Synonym Protein Names

Opa-interacting protein 1; OIP-1; Zyxin-related protein 1; ZRP-1

Protein Family

Thyroid receptor-interacting protein

UniProt Gene Name

TRIP6

UniProt Synonym Gene Names

OIP1; TR-interacting protein 6; TRIP-6; OIP-1; ZRP-1

UniProt Entry Name

TRIP6_HUMAN

NCBI Protein Information

thyroid receptor-interacting protein 6

UniProt Comments for TRIP6

TRIP6: thyroid receptor interacting protein 6 specifically interacts with the ligand-binding domain of the thyroid receptor (TR). Requires the presence of thyroid hormone for its interaction. Interacts with PTPN13. Functions downstream of the activated LPA(2) receptor and is involved in cell adhesion and migration.

Protein type: Nuclear receptor co-regulator; Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: interleukin-1 receptor complex; cytoskeleton; focal adhesion; cytoplasm; plasma membrane; nucleus

Molecular Function: protein binding; interleukin-1 receptor binding; zinc ion binding; thyroid hormone receptor binding; kinase binding

Biological Process: release of cytoplasmic sequestered NF-kappaB; focal adhesion formation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of cell migration

Research Articles on TRIP6

1. High TRIP6 expression is associated with Cell Proliferation, Cell Migration and Invasion in Endometrial Carcinoma.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.